SCOPe 2.08: Domain d1a6sa_: 1a6s A:

Lineage for d1a6sa_ (1a6s A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.4: GAG polyprotein M-domain [47848] (2 proteins)
   the C-terminal helix region is missing(?)
   automatically mapped to Pfam PF02813

6. Protein GAG polyprotein M-domain [47849] (1 species)

7. Species Rous sarcoma virus [TaxId:11886] [47850] (1 PDB entry)

8. Domain d1a6sa_: 1a6s A: [18134]

Details for d1a6sa_

PDB Entry: 1a6s

PDB Description: m-domain from gag polyprotein of rous sarcoma virus, nmr, 20 structures

PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d1a6sa_:

Sequence; same for both SEQRES and ATOM records:

>d1a6sa_ a.61.1.4 (A:) GAG polyprotein M-domain {Rous sarcoma virus [TaxId: 11886]}
geavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaalsq
ramilgksgelktwglvlgalkaaree

Timeline for d1a6sa_:

• d1a6sa_ first appeared (with stable ids) in SCOP 1.55, called d1a6s__
  
• d1a6sa_ appears in SCOPe 2.07