Lineage for d1bax__ (1bax -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539870Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 539871Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 539893Family a.61.1.3: Mason-Pfizer monkey virus matrix protein [47845] (1 protein)
    the C-terminal helix region is missing(?)
  6. 539894Protein Mason-Pfizer monkey virus matrix protein [47846] (1 species)
  7. 539895Species Simian Mason-Pfizer virus [TaxId:11855] [47847] (1 PDB entry)
  8. 539896Domain d1bax__: 1bax - [18133]

Details for d1bax__

PDB Entry: 1bax (more details)

PDB Description: mason-pfizer monkey virus matrix protein, nmr, average structure

SCOP Domain Sequences for d1bax__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bax__ a.61.1.3 (-) Mason-Pfizer monkey virus matrix protein {Simian Mason-Pfizer virus}
mgqelsqheryveqlkqalktrgvkvkyadllkffdfvkdtcpwfpqegtidikrwrrvg
dcfqdyyntfgpekvpvtafsywnlikelidkke

SCOP Domain Coordinates for d1bax__:

Click to download the PDB-style file with coordinates for d1bax__.
(The format of our PDB-style files is described here.)

Timeline for d1bax__: