SCOPe 2.08: Domain d1baxa_: 1bax A:

Lineage for d1baxa_ (1bax A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.3: Mason-Pfizer monkey virus matrix protein [47845] (1 protein)
   the C-terminal helix region is missing(?)
   automatically mapped to Pfam PF02337

6. Protein Mason-Pfizer monkey virus matrix protein [47846] (1 species)

7. Species Simian Mason-Pfizer virus [TaxId:11855] [47847] (3 PDB entries)

8. Domain d1baxa_: 1bax A: [18133]

Details for d1baxa_

PDB Entry: 1bax

PDB Description: mason-pfizer monkey virus matrix protein, nmr, average structure

PDB Compounds: (A:) m-pmv matrix protein

SCOPe Domain Sequences for d1baxa_:

Sequence; same for both SEQRES and ATOM records:

>d1baxa_ a.61.1.3 (A:) Mason-Pfizer monkey virus matrix protein {Simian Mason-Pfizer virus [TaxId: 11855]}
mgqelsqheryveqlkqalktrgvkvkyadllkffdfvkdtcpwfpqegtidikrwrrvg
dcfqdyyntfgpekvpvtafsywnlikelidkke

Timeline for d1baxa_:

• d1baxa_ first appeared (with stable ids) in SCOP 1.55, called d1bax__
  
• d1baxa_ appears in SCOPe 2.07