SCOPe 2.08: Domain d3mk5a1: 3mk5 A:1-206

Lineage for d3mk5a1 (3mk5 A:1-206)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.115: YrdC/RibB [55820] (1 superfamily)
   core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other

4. Superfamily d.115.1: YrdC/RibB [55821] (3 families)

5. Family d.115.1.0: automated matches [191657] (1 protein)
   not a true family

6. Protein automated matches [191228] (2 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:419947] [189646] (3 PDB entries)

8. Domain d3mk5a1: 3mk5 A:1-206 [181324]
   Other proteins in same PDB: d3mk5a2
   automated match to d1tksa_
   complexed with so4, zn

Details for d3mk5a1

PDB Entry: 3mk5, 2.06 Å

PDB Description: Crystal structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase domain from Mycobacterium tuberculosis with sulfate and zinc at pH 4.00

PDB Compounds: (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d3mk5a1:

Sequence, based on SEQRES records:

>d3mk5a1 d.115.1.0 (A:1-206) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
mtrldsveravadiaagkavividdedrenegdlifaaekatpemvafmvrytsgylcvp
ldgaicdrlgllpmyavnqdkhgtaytvtvdarngigtgisasdrattmrlladptsvad
dftrpghvvplrakdggvlrrpghteaavdlarmaglqpagaiceivsqkdegsmahtde
lrvfadehglalitiadliewrrkhe

Sequence, based on observed residues (ATOM records):

>d3mk5a1 d.115.1.0 (A:1-206) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
mtrldsveravadiaagkavividdedegdlifaaekatpemvafmvrytsgylcvpldg
aicdrlgllpmytvtvdarngigtgisasdrattmrlladptsvaddftrpghvvplrak
dggvlrrpghteaavdlarmaglqpagaiceivsdegsmahtdelrvfadehglalitia
dliewrrkhe

Timeline for d3mk5a1:

• d3mk5a1 first appeared in SCOPe 2.01, called d3mk5a_
  
• d3mk5a1 appears in SCOPe 2.07