Lineage for d1jvr__ (1jvr -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48908Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
  4. 48909Superfamily a.61.1: Retroviral matrix proteins [47836] (4 families) (S)
  5. 48925Family a.61.1.2: HTLV-II matrix protein [47842] (1 protein)
  6. 48926Protein HTLV-II matrix protein [47843] (1 species)
  7. 48927Species Human T-cell leukemia virus type 2 [TaxId:11909] [47844] (1 PDB entry)
  8. 48928Domain d1jvr__: 1jvr - [18132]

Details for d1jvr__

PDB Entry: 1jvr (more details)

PDB Description: structure of the htlv-ii matrix protein, nmr, 20 structures

SCOP Domain Sequences for d1jvr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jvr__ a.61.1.2 (-) HTLV-II matrix protein {Human T-cell leukemia virus type 2}
hmgqihglsptpipkaprglsthhwlnflqaayrlqpgpsdfdfqqlrrflklalktpiw
lnpidysllaslipkgypgrvveiinilvknqvspsapaapvptpicptttpppppppsp
eahvpppyveptttqcf

SCOP Domain Coordinates for d1jvr__:

Click to download the PDB-style file with coordinates for d1jvr__.
(The format of our PDB-style files is described here.)

Timeline for d1jvr__: