Lineage for d3mjzk_ (3mjz K:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961445Family d.80.1.0: automated matches [191533] (1 protein)
    not a true family
  6. 2961446Protein automated matches [190903] (22 species)
    not a true protein
  7. 2961500Species Coryneform bacterium [TaxId:1728] [189898] (4 PDB entries)
  8. 2961533Domain d3mjzk_: 3mjz K: [181319]
    automated match to d2aaga1

Details for d3mjzk_

PDB Entry: 3mjz (more details), 2.4 Å

PDB Description: the crystal structure of native fg41 msad
PDB Compounds: (K:) FG41 Malonate Semialdehyde Decarboxylase

SCOPe Domain Sequences for d3mjzk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mjzk_ d.80.1.0 (K:) automated matches {Coryneform bacterium [TaxId: 1728]}
pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
aqyvtgelai

SCOPe Domain Coordinates for d3mjzk_:

Click to download the PDB-style file with coordinates for d3mjzk_.
(The format of our PDB-style files is described here.)

Timeline for d3mjzk_: