SCOPe 2.08: Domain d1ecwa_: 1ecw A:

Lineage for d1ecwa_ (1ecw A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
   automatically mapped to Pfam PF00540

6. Protein SIV matrix antigen [47840] (1 species)

7. Species Simian immunodeficiency virus [TaxId:11723] [47841] (2 PDB entries)

8. Domain d1ecwa_: 1ecw A: [18131]
   complexed with ipa

Details for d1ecwa_

PDB Entry: 1ecw, 2.2 Å

PDB Description: crystal structure of simian immunodeficiency virus matrix antigen (siv ma) at 293k.

PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d1ecwa_:

Sequence; same for both SEQRES and ATOM records:

>d1ecwa_ a.61.1.1 (A:) SIV matrix antigen {Simian immunodeficiency virus [TaxId: 11723]}
svlsgkkadelekirlrpggkkkymlkhvvwaaneldrfglaesllenkegcqkilsvla
plvptgsenlkslyntvcviwcihaeekvkhteeakqivqrhlvvetgtaetmp

Timeline for d1ecwa_:

• d1ecwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ecwa_ appears in SCOPe 2.07