Lineage for d1ecwa_ (1ecw A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716789Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 2716790Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 2716791Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
    automatically mapped to Pfam PF00540
  6. 2716821Protein SIV matrix antigen [47840] (1 species)
  7. 2716822Species Simian immunodeficiency virus [TaxId:11723] [47841] (2 PDB entries)
  8. 2716823Domain d1ecwa_: 1ecw A: [18131]
    complexed with ipa

Details for d1ecwa_

PDB Entry: 1ecw (more details), 2.2 Å

PDB Description: crystal structure of simian immunodeficiency virus matrix antigen (siv ma) at 293k.
PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d1ecwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecwa_ a.61.1.1 (A:) SIV matrix antigen {Simian immunodeficiency virus [TaxId: 11723]}
svlsgkkadelekirlrpggkkkymlkhvvwaaneldrfglaesllenkegcqkilsvla
plvptgsenlkslyntvcviwcihaeekvkhteeakqivqrhlvvetgtaetmp

SCOPe Domain Coordinates for d1ecwa_:

Click to download the PDB-style file with coordinates for d1ecwa_.
(The format of our PDB-style files is described here.)

Timeline for d1ecwa_: