Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (44 species) not a true protein |
Species Coturnix japonica [TaxId:93934] [189557] (1 PDB entry) |
Domain d3mjpd_: 3mjp D: [181308] automated match to d1hbrd_ complexed with hem, oxy |
PDB Entry: 3mjp (more details), 2.76 Å
SCOPe Domain Sequences for d3mjpd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mjpd_ a.1.1.2 (D:) automated matches {Coturnix japonica [TaxId: 93934]} vhwsaeekqlitglwgkvnvaecgaealarllivypwtqrffasfgnlssptailgnpmv rahgkkvltsfgdavknldnikntfsqlselhcdklhvdpenfrllgdiliivlaahftk dftpecqaawqklvrvvahalarkyh
Timeline for d3mjpd_: