Lineage for d3mjpd_ (3mjp D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301856Protein automated matches [190359] (44 species)
    not a true protein
  7. 2302068Species Coturnix japonica [TaxId:93934] [189557] (1 PDB entry)
  8. 2302072Domain d3mjpd_: 3mjp D: [181308]
    automated match to d1hbrd_
    complexed with hem, oxy

Details for d3mjpd_

PDB Entry: 3mjp (more details), 2.76 Å

PDB Description: crystal structure determination of japanese quail (coturnix coturnix japonica) hemoglobin at 2.76 angstrom resolution
PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3mjpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mjpd_ a.1.1.2 (D:) automated matches {Coturnix japonica [TaxId: 93934]}
vhwsaeekqlitglwgkvnvaecgaealarllivypwtqrffasfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfsqlselhcdklhvdpenfrllgdiliivlaahftk
dftpecqaawqklvrvvahalarkyh

SCOPe Domain Coordinates for d3mjpd_:

Click to download the PDB-style file with coordinates for d3mjpd_.
(The format of our PDB-style files is described here.)

Timeline for d3mjpd_: