Lineage for d3mjpa_ (3mjp A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688618Species Coturnix japonica [TaxId:93934] [189557] (1 PDB entry)
  8. 2688619Domain d3mjpa_: 3mjp A: [181306]
    automated match to d1fawa_
    complexed with hem, oxy

Details for d3mjpa_

PDB Entry: 3mjp (more details), 2.76 Å

PDB Description: crystal structure determination of japanese quail (coturnix coturnix japonica) hemoglobin at 2.76 angstrom resolution
PDB Compounds: (A:) Hemoglobin subunit alpha-A

SCOPe Domain Sequences for d3mjpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mjpa_ a.1.1.2 (A:) automated matches {Coturnix japonica [TaxId: 93934]}
vlsaadktnvkgifakiaghaeeygaealdrmfttypqtktyfphfdvshgsaqikghgk
kvaaalveaanhiddiagtlsklsdlhaqklrvdpvnfkllgqcflvvvaihhpaaltpe
vhasldkflcavgtvltakyr

SCOPe Domain Coordinates for d3mjpa_:

Click to download the PDB-style file with coordinates for d3mjpa_.
(The format of our PDB-style files is described here.)

Timeline for d3mjpa_: