Lineage for d3mjoa_ (3mjo A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703463Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 2703476Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (6 PDB entries)
  8. 2703477Domain d3mjoa_: 3mjo A: [181304]
    automated match to d1kgna_
    complexed with mn3

Details for d3mjoa_

PDB Entry: 3mjo (more details), 1.36 Å

PDB Description: small subunit (r2f) of native ribonucleotide reductase from corynebacterium ammoniagenes
PDB Compounds: (A:) Ribonucleotide reductase subunit R2F

SCOPe Domain Sequences for d3mjoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mjoa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

SCOPe Domain Coordinates for d3mjoa_:

Click to download the PDB-style file with coordinates for d3mjoa_.
(The format of our PDB-style files is described here.)

Timeline for d3mjoa_: