Lineage for d3mjmb_ (3mjm B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1820872Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1821100Family c.1.9.4: Dihydroorotase [63917] (2 proteins)
  6. 1821129Protein automated matches [191232] (2 species)
    not a true protein
  7. 1821130Species Escherichia coli [TaxId:481805] [189653] (1 PDB entry)
  8. 1821132Domain d3mjmb_: 3mjm B: [181303]
    automated match to d1j79a_
    complexed with cp, dor, ncd, zn; mutant

Details for d3mjmb_

PDB Entry: 3mjm (more details), 1.87 Å

PDB Description: his257ala mutant of dihydroorotase from e. coli
PDB Compounds: (B:) dihydroorotase

SCOPe Domain Sequences for d3mjmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mjmb_ c.1.9.4 (B:) automated matches {Escherichia coli [TaxId: 481805]}
sqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqril
davpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvdaim
pvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkda
adyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgfn
rvflgtdsaphararkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqfy
glpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk

SCOPe Domain Coordinates for d3mjmb_:

Click to download the PDB-style file with coordinates for d3mjmb_.
(The format of our PDB-style files is described here.)

Timeline for d3mjmb_: