Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.4: Dihydroorotase [63917] (2 proteins) |
Protein automated matches [191232] (2 species) not a true protein |
Species Escherichia coli [TaxId:481805] [189653] (1 PDB entry) |
Domain d3mjmb_: 3mjm B: [181303] automated match to d1j79a_ complexed with cp, dor, ncd, zn; mutant |
PDB Entry: 3mjm (more details), 1.87 Å
SCOPe Domain Sequences for d3mjmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mjmb_ c.1.9.4 (B:) automated matches {Escherichia coli [TaxId: 481805]} sqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqril davpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvdaim pvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkda adyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgfn rvflgtdsaphararkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqfy glpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk
Timeline for d3mjmb_: