Lineage for d3mj1a_ (3mj1 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931430Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 1931431Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
    Uniprot Q08881 357-619
  8. 1931440Domain d3mj1a_: 3mj1 A: [181296]
    automated match to d1sm2a_
    complexed with 614

Details for d3mj1a_

PDB Entry: 3mj1 (more details), 1.72 Å

PDB Description: X-ray crystal structure of ITK complexed with inhibitor RO5191614
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d3mj1a_:

Sequence, based on SEQRES records: (download)

>d3mj1a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkls
hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle
easvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsr
yssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhc
wkerpedrpafsrllrqlaai

Sequence, based on observed residues (ATOM records): (download)

>d3mj1a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgglvhlgywlnkdkvaiktieeaevmmklshpklvqlygvcle
qapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeasvihrdlaarn
clvgenqvikvsdfpvkwaspevfsfsryssksdvwsfgvlmwevfsegkipyersnsev
vedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaai

SCOPe Domain Coordinates for d3mj1a_:

Click to download the PDB-style file with coordinates for d3mj1a_.
(The format of our PDB-style files is described here.)

Timeline for d3mj1a_: