SCOPe 2.03: Domain d3mj0a_: 3mj0 A:

Lineage for d3mj0a_ (3mj0 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.14: PAZ domain [101690] (1 family)

5. Family b.34.14.1: PAZ domain [101691] (6 proteins)

6. Protein automated matches [191296] (1 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189964] (1 PDB entry)

8. Domain d3mj0a_: 3mj0 A: [181295]
   automated match to d1t2ra_
   protein/RNA complex

Details for d3mj0a_

PDB Entry: 3mj0, 2.31 Å

PDB Description: Crystal Structure of Drosophia Ago-PAZ domain in complex with 3'-end 2'-O-methylated RNA

PDB Compounds: (A:) Protein argonaute-2

SCOPe Domain Sequences for d3mj0a_:

Sequence; same for both SEQRES and ATOM records:

>d3mj0a_ b.34.14.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ssmpmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvngl
srapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee

Timeline for d3mj0a_:

• d3mj0a_ first appeared in SCOPe 2.01
  
• d3mj0a_ appears in SCOPe 2.02
  
• d3mj0a_ appears in SCOPe 2.04
  
• d3mj0a_ appears in the current release, SCOPe 2.08, called d3mj0a1