Lineage for d3mj0a1 (3mj0 A:601-717)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785260Superfamily b.34.14: PAZ domain [101690] (2 families) (S)
  5. 2785261Family b.34.14.1: PAZ domain [101691] (6 proteins)
  6. 2785291Protein automated matches [191296] (2 species)
    not a true protein
  7. 2785297Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189964] (2 PDB entries)
  8. 2785298Domain d3mj0a1: 3mj0 A:601-717 [181295]
    Other proteins in same PDB: d3mj0a2
    automated match to d1t2ra_
    protein/RNA complex

Details for d3mj0a1

PDB Entry: 3mj0 (more details), 2.31 Å

PDB Description: Crystal Structure of Drosophia Ago-PAZ domain in complex with 3'-end 2'-O-methylated RNA
PDB Compounds: (A:) Protein argonaute-2

SCOPe Domain Sequences for d3mj0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mj0a1 b.34.14.1 (A:601-717) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
smpmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvngls
rapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee

SCOPe Domain Coordinates for d3mj0a1:

Click to download the PDB-style file with coordinates for d3mj0a1.
(The format of our PDB-style files is described here.)

Timeline for d3mj0a1: