SCOPe 2.08: Domain d3mj0a1: 3mj0 A:601-717

Lineage for d3mj0a1 (3mj0 A:601-717)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.14: PAZ domain [101690] (2 families)

5. Family b.34.14.1: PAZ domain [101691] (6 proteins)

6. Protein automated matches [191296] (2 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189964] (2 PDB entries)

8. Domain d3mj0a1: 3mj0 A:601-717 [181295]
   Other proteins in same PDB: d3mj0a2
   automated match to d1t2ra_
   protein/RNA complex

Details for d3mj0a1

PDB Entry: 3mj0, 2.31 Å

PDB Description: Crystal Structure of Drosophia Ago-PAZ domain in complex with 3'-end 2'-O-methylated RNA

PDB Compounds: (A:) Protein argonaute-2

SCOPe Domain Sequences for d3mj0a1:

Sequence; same for both SEQRES and ATOM records:

>d3mj0a1 b.34.14.1 (A:601-717) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
smpmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvngls
rapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee

Timeline for d3mj0a1:

• d3mj0a1 first appeared in SCOPe 2.01, called d3mj0a_
  
• d3mj0a1 appears in SCOPe 2.07