Lineage for d3miya1 (3miy A:357-619)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983087Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 2983088Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
    Uniprot Q08881 357-619
  8. 2983095Domain d3miya1: 3miy A:357-619 [181293]
    Other proteins in same PDB: d3miya2, d3miyb2
    automated match to d1sm2a_
    complexed with b49

Details for d3miya1

PDB Entry: 3miy (more details), 1.67 Å

PDB Description: x-ray crystal structure of itk complexed with sunitinib
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d3miya1:

Sequence, based on SEQRES records: (download)

>d3miya1 d.144.1.7 (A:357-619) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
svihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsrys
sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
erpedrpafsrllrqlaaiaasg

Sequence, based on observed residues (ATOM records): (download)

>d3miya1 d.144.1.7 (A:357-619) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgglvhlgywlnkdkvaiktiseedfieeaevmmklshpklvqlyg
vcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeasvihrdl
aarnclvgenqvikvsdfpvkwaspevfsfsryssksdvwsfgvlmwevfsegkipyenr
snsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaaiaasg

SCOPe Domain Coordinates for d3miya1:

Click to download the PDB-style file with coordinates for d3miya1.
(The format of our PDB-style files is described here.)

Timeline for d3miya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3miya2