SCOPe 2.08: Domain d3miub_: 3miu B:

Lineage for d3miub_ (3miu B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.77: beta-Prism I [51091] (4 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.0: automated matches [191397] (1 protein)
   not a true family

6. Protein automated matches [190516] (5 species)
   not a true protein

7. Species Musa acuminata [TaxId:4641] [187471] (10 PDB entries)

8. Domain d3miub_: 3miu B: [181292]
   automated match to d1c3ka_
   complexed with hez, man, zn

Details for d3miub_

PDB Entry: 3miu, 2.63 Å

PDB Description: structure of banana lectin-pentamannose complex

PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d3miub_:

Sequence; same for both SEQRES and ATOM records:

>d3miub_ b.77.3.0 (B:) automated matches {Musa acuminata [TaxId: 4641]}
ngaikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsggt
pheivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagki
sgffgrggdfidaigvylep

Timeline for d3miub_:

• d3miub_ first appeared in SCOPe 2.01
  
• d3miub_ appears in SCOPe 2.07