SCOPe 2.05: Domain d3mita_: 3mit A:

Lineage for d3mita_ (3mit A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.0: automated matches [191397] (1 protein)
   not a true family

6. Protein automated matches [190516] (2 species)
   not a true protein

7. Species Musa acuminata [TaxId:4641] [187471] (10 PDB entries)

8. Domain d3mita_: 3mit A: [181289]
   automated match to d1c3ka_
   complexed with hez, man, zn

Details for d3mita_

PDB Entry: 3mit, 2.32 Å

PDB Description: structure of banana lectin-alpha-d-mannose complex

PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d3mita_:

Sequence; same for both SEQRES and ATOM records:

>d3mita_ b.77.3.0 (A:) automated matches {Musa acuminata [TaxId: 4641]}
aikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsggtph
eivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagkisg
ffgrggdfidaigvylep

Timeline for d3mita_:

• d3mita_ first appeared in SCOPe 2.01
  
• d3mita_ appears in SCOPe 2.04
  
• d3mita_ appears in SCOPe 2.06
  
• d3mita_ appears in the current release, SCOPe 2.08