SCOPe 2.06: Domain d3mioa_: 3mio A:

Lineage for d3mioa_ (3mio A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.115: YrdC/RibB [55820] (1 superfamily)
   core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other

4. Superfamily d.115.1: YrdC/RibB [55821] (3 families)

5. Family d.115.1.0: automated matches [191657] (1 protein)
   not a true family

6. Protein automated matches [191228] (2 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:419947] [189646] (3 PDB entries)

8. Domain d3mioa_: 3mio A: [181287]
   automated match to d1tksa_
   complexed with gol, k, po4

Details for d3mioa_

PDB Entry: 3mio, 1.8 Å

PDB Description: Crystal structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase domain from Mycobacterium tuberculosis at pH 6.00

PDB Compounds: (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d3mioa_:

Sequence, based on SEQRES records:

>d3mioa_ d.115.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
mtrldsveravadiaagkavividdedrenegdlifaaekatpemvafmvrytsgylcvp
ldgaicdrlgllpmyavnqdkhgtaytvtvdarngigtgisasdrattmrlladptsvad
dftrpghvvplrakdggvlrrpghteaavdlarmaglqpagaiceivsqkdegsmahtde
lrvfadehglalitiadliewrrkhe

Sequence, based on observed residues (ATOM records):

>d3mioa_ d.115.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
mtrldsveravadiaagkavividdedrenegdlifaaekatpemvafmvrytsgylcvp
ldgaicdrlgllpmytvtvdarngigtgisasdrattmrlladptsvaddftrpghvvpl
rakdggvlrrpghteaavdlarmaglqpagaiceivsqkdegsmahtdelrvfadehgla
litiadliewrrkhe

Timeline for d3mioa_:

• d3mioa_ first appeared in SCOPe 2.01
  
• d3mioa_ appears in SCOPe 2.05
  
• d3mioa_ appears in SCOPe 2.07
  
• d3mioa_ appears in the current release, SCOPe 2.08