SCOPe 2.06: Domain d3miib_: 3mii B:

Lineage for d3miib_ (3mii B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein automated matches [190995] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189556] (1 PDB entry)

8. Domain d3miib_: 3mii B: [181286]
   automated match to d1qvvb_
   complexed with gol, pge, so4

Details for d3miib_

PDB Entry: 3mii, 2.4 Å

PDB Description: Crystal structure of Y0R391Cp/HSP33 from Saccharomyces cerevisiae

PDB Compounds: (B:) Probable chaperone protein HSP33

SCOPe Domain Sequences for d3miib_:

Sequence; same for both SEQRES and ATOM records:

>d3miib_ c.23.16.2 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pkralisltsyhgpfykdgaktgvfvveilrsfdtfekhgfevdfvsetggfgwdehylp
ksfiggedkmnfetknsafnkalariktanevnasdykvffasaghgalfdypkaknlqd
iaskiyanggviaaichgpllfdglidikttrpliegkaitgfplegeialgvddilrsr
klttvervankngakylapihpwddysitdgklvtgvnanssysttirainalys

Timeline for d3miib_:

• d3miib_ first appeared in SCOPe 2.01
  
• d3miib_ appears in SCOPe 2.05
  
• d3miib_ appears in SCOPe 2.07
  
• d3miib_ appears in the current release, SCOPe 2.08