Lineage for d3miia_ (3mii A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 984114Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 984253Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 984355Protein automated matches [190995] (3 species)
    not a true protein
  7. 984358Species Saccharomyces cerevisiae [TaxId:559292] [189556] (1 PDB entry)
  8. 984359Domain d3miia_: 3mii A: [181285]
    automated match to d1qvvb_
    complexed with gol, pge, so4

Details for d3miia_

PDB Entry: 3mii (more details), 2.4 Å

PDB Description: Crystal structure of Y0R391Cp/HSP33 from Saccharomyces cerevisiae
PDB Compounds: (A:) Probable chaperone protein HSP33

SCOPe Domain Sequences for d3miia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3miia_ c.23.16.2 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
kralisltsyhgpfykdgaktgvfvveilrsfdtfekhgfevdfvsetggfgwdehylpk
sfiggedkmnfetknsafnkalariktanevnasdykvffasaghgalfdypkaknlqdi
askiyanggviaaichgpllfdglidikttrpliegkaitgfplegeialgvddilrsrk
lttvervankngakylapihpwddysitdgklvtgvnanssysttirainalys

SCOPe Domain Coordinates for d3miia_:

Click to download the PDB-style file with coordinates for d3miia_.
(The format of our PDB-style files is described here.)

Timeline for d3miia_: