| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
| Protein automated matches [190995] (3 species) not a true protein |
| Species Saccharomyces cerevisiae [TaxId:559292] [189556] (1 PDB entry) |
| Domain d3miia_: 3mii A: [181285] automated match to d1qvvb_ complexed with gol, pge, so4 |
PDB Entry: 3mii (more details), 2.4 Å
SCOPe Domain Sequences for d3miia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3miia_ c.23.16.2 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
kralisltsyhgpfykdgaktgvfvveilrsfdtfekhgfevdfvsetggfgwdehylpk
sfiggedkmnfetknsafnkalariktanevnasdykvffasaghgalfdypkaknlqdi
askiyanggviaaichgpllfdglidikttrpliegkaitgfplegeialgvddilrsrk
lttvervankngakylapihpwddysitdgklvtgvnanssysttirainalys
Timeline for d3miia_: