Lineage for d3mi7x_ (3mi7 X:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2559568Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 2559569Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)
  6. 2559579Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 2559591Species Human papillomavirus type 16 [TaxId:333760] [54962] (5 PDB entries)
    Uniprot P03120 286-365
  8. 2559594Domain d3mi7x_: 3mi7 X: [181284]
    automated match to d1r8pa_
    complexed with edo

Details for d3mi7x_

PDB Entry: 3mi7 (more details), 2.2 Å

PDB Description: an enhanced repressor of human papillomavirus e2 protein
PDB Compounds: (X:) Regulatory protein E2

SCOPe Domain Sequences for d3mi7x_:

Sequence, based on SEQRES records: (download)

>d3mi7x_ d.58.8.1 (X:) Papillomavirus-1 E2 protein {Human papillomavirus type 16 [TaxId: 333760]}
nttpivelkgdantlkclryrfkkhstlytavsstwhwtghnvkhksaivtltydsewqr
dqflsqvkipktitvstgfmsi

Sequence, based on observed residues (ATOM records): (download)

>d3mi7x_ d.58.8.1 (X:) Papillomavirus-1 E2 protein {Human papillomavirus type 16 [TaxId: 333760]}
nttpivelkgdantlkclryrfkkhstlytavsstwhwtghnvkksaivtltydsewqrd
qflsqvkipktitvstgfmsi

SCOPe Domain Coordinates for d3mi7x_:

Click to download the PDB-style file with coordinates for d3mi7x_.
(The format of our PDB-style files is described here.)

Timeline for d3mi7x_: