Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) |
Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins) |
Protein Papillomavirus-1 E2 protein [54959] (5 species) forms dimers with subunit beta-sheets making (8,12) barrel |
Species Human papillomavirus type 16 [TaxId:333760] [54962] (5 PDB entries) Uniprot P03120 286-365 |
Domain d3mi7x_: 3mi7 X: [181284] automated match to d1r8pa_ complexed with edo |
PDB Entry: 3mi7 (more details), 2.2 Å
SCOPe Domain Sequences for d3mi7x_:
Sequence, based on SEQRES records: (download)
>d3mi7x_ d.58.8.1 (X:) Papillomavirus-1 E2 protein {Human papillomavirus type 16 [TaxId: 333760]} nttpivelkgdantlkclryrfkkhstlytavsstwhwtghnvkhksaivtltydsewqr dqflsqvkipktitvstgfmsi
>d3mi7x_ d.58.8.1 (X:) Papillomavirus-1 E2 protein {Human papillomavirus type 16 [TaxId: 333760]} nttpivelkgdantlkclryrfkkhstlytavsstwhwtghnvkksaivtltydsewqrd qflsqvkipktitvstgfmsi
Timeline for d3mi7x_: