SCOPe 2.07: Domain d1tama_: 1tam A:

Lineage for d1tama_ (1tam A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 protein domains)
   automatically mapped to Pfam PF00540

6. Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species)
   topologically similar to one subunit in the interferon-gamma intertwined dimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (10 PDB entries)

8. Domain d1tama_: 1tam A: [18128]

Details for d1tama_

PDB Entry: 1tam

PDB Description: human immunodeficiency virus, nmr, minimized average structure

PDB Compounds: (A:) hiv-1 matrix protein

SCOPe Domain Sequences for d1tama_:

Sequence; same for both SEQRES and ATOM records:

>d1tama_ a.61.1.1 (A:) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1 [TaxId: 11676]}
mgarasvlsggeldrwekirlrpggkkkyklkhivwasrelerfavnpglletsegcrqi
lgqlqpslqtgseelrslyntvatlycvhqrieikdtkealdkieeeqnkskkkaqqaaa

Timeline for d1tama_:

• d1tama_ first appeared (with stable ids) in SCOP 1.55, called d1tam__
  
• d1tama_ appears in SCOPe 2.06