| Class b: All beta proteins [48724] (174 folds) |
| Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) ![]() |
| Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
| Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species) alpha and beta chains are derived from a single-chain protomer and share this fold |
| Species Pseudomonas putida [TaxId:303] [49487] (29 PDB entries) |
| Domain d3mi5c_: 3mi5 C: [181274] Other proteins in same PDB: d3mi5m_, d3mi5n_, d3mi5o_, d3mi5p_, d3mi5q_, d3mi5r_ automated match to d1ykka1 complexed with bme, caq, cl, fe, gol, so4; mutant |
PDB Entry: 3mi5 (more details), 1.78 Å
SCOPe Domain Sequences for d3mi5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mi5c_ b.3.6.1 (C:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf
Timeline for d3mi5c_: