SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3mi5a_ (3mi5 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2035756Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2035757Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 protein domains)
    sandwich; 9 strands in 2 sheets
  6. 2035780Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 2035788Species Pseudomonas putida [TaxId:303] [49487] (36 PDB entries)
  8. 2035822Domain d3mi5a_: 3mi5 A: [181272]
    Other proteins in same PDB: d3mi5m_, d3mi5n_, d3mi5o_, d3mi5p_, d3mi5q_, d3mi5r_
    automated match to d1ykka1
    complexed with bme, caq, cl, fe, gol, so4; mutant

Details for d3mi5a_

PDB Entry: 3mi5 (more details), 1.78 Å

PDB Description: Axial Ligand Swapping In Double Mutant Maintains Intradiol-cleavage Chemistry in Protocatechuate 3,4-Dioxygenase
PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d3mi5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mi5a_ b.3.6.1 (A:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOPe Domain Coordinates for d3mi5a_:

Click to download the PDB-style file with coordinates for d3mi5a_.
(The format of our PDB-style files is described here.)

Timeline for d3mi5a_: