SCOPe 2.05: Domain d3mi1c_: 3mi1 C:

Lineage for d3mi1c_ (3mi1 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
   alpha and beta chains are derived from a single-chain protomer and share this fold

7. Species Pseudomonas putida [TaxId:303] [49487] (36 PDB entries)

8. Domain d3mi1c_: 3mi1 C: [181267]
   Other proteins in same PDB: d3mi1m_, d3mi1n_, d3mi1o_
   automated match to d1ykka1
   complexed with bme, cl, fe, gol, so4; mutant

Details for d3mi1c_

PDB Entry: 3mi1, 1.74 Å

PDB Description: axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase

PDB Compounds: (C:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d3mi1c_:

Sequence; same for both SEQRES and ATOM records:

>d3mi1c_ b.3.6.1 (C:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

Timeline for d3mi1c_:

• d3mi1c_ first appeared in SCOPe 2.01
  
• d3mi1c_ appears in SCOPe 2.04
  
• d3mi1c_ appears in SCOPe 2.06
  
• d3mi1c_ appears in the current release, SCOPe 2.08