![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.61: Retroviral matrix proteins [47835] (1 superfamily) 4-5 helices; right-handed superhelix |
![]() | Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) ![]() the 5th, C-terminal helix is missing in some of the member structures |
![]() | Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins) automatically mapped to Pfam PF00540 |
![]() | Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species) topologically similar to one subunit in the interferon-gamma intertwined dimer |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (14 PDB entries) |
![]() | Domain d1hiwr_: 1hiw R: [18126] complexed with so4 |
PDB Entry: 1hiw (more details), 2.3 Å
SCOPe Domain Sequences for d1hiwr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hiwr_ a.61.1.1 (R:) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1 [TaxId: 11676]} vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlqp slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqa
Timeline for d1hiwr_: