Lineage for d1hiwc_ (1hiw C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4521Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
  4. 4522Superfamily a.61.1: Retroviral matrix proteins [47836] (4 families) (S)
  5. 4523Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (2 proteins)
  6. 4524Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species)
  7. 4525Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (3 PDB entries)
  8. 4528Domain d1hiwc_: 1hiw C: [18124]

Details for d1hiwc_

PDB Entry: 1hiw (more details), 2.3 Å

PDB Description: trimeric hiv-1 matrix protein

SCOP Domain Sequences for d1hiwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hiwc_ a.61.1.1 (C:) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1}
vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlqp
slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaa

SCOP Domain Coordinates for d1hiwc_:

Click to download the PDB-style file with coordinates for d1hiwc_.
(The format of our PDB-style files is described here.)

Timeline for d1hiwc_: