Lineage for d1hiwc_ (1hiw C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716789Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 2716790Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 2716791Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
    automatically mapped to Pfam PF00540
  6. 2716792Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species)
    topologically similar to one subunit in the interferon-gamma intertwined dimer
  7. 2716793Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (14 PDB entries)
  8. 2716809Domain d1hiwc_: 1hiw C: [18124]
    complexed with so4

Details for d1hiwc_

PDB Entry: 1hiw (more details), 2.3 Å

PDB Description: trimeric hiv-1 matrix protein
PDB Compounds: (C:) hiv-1 matrix protein

SCOPe Domain Sequences for d1hiwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hiwc_ a.61.1.1 (C:) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1 [TaxId: 11676]}
vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlqp
slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaa

SCOPe Domain Coordinates for d1hiwc_:

Click to download the PDB-style file with coordinates for d1hiwc_.
(The format of our PDB-style files is described here.)

Timeline for d1hiwc_: