SCOPe 2.06: Domain d3mhyb_: 3mhy B:

Lineage for d3mhyb_ (3mhy B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein automated matches [190670] (6 species)
   not a true protein

7. Species Azospirillum brasilense [TaxId:192] [189362] (11 PDB entries)

8. Domain d3mhyb_: 3mhy B: [181234]
   automated match to d1gnka_
   complexed with akg, atp, mes, mg, pg6

Details for d3mhyb_

PDB Entry: 3mhy, 1.4 Å

PDB Description: A New PII Protein Structure

PDB Compounds: (B:) PII-like protein Pz

SCOPe Domain Sequences for d3mhyb_:

Sequence; same for both SEQRES and ATOM records:

>d3mhyb_ d.58.5.1 (B:) automated matches {Azospirillum brasilense [TaxId: 192]}
mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgqteiyrgaeysvsflpkvk
vevavsddqyeqvveaiqkaantgrigdgkifvldiaqavrirtgetnteal

Timeline for d3mhyb_:

• d3mhyb_ first appeared in SCOPe 2.01
  
• d3mhyb_ appears in SCOPe 2.05
  
• d3mhyb_ appears in SCOPe 2.07
  
• d3mhyb_ appears in the current release, SCOPe 2.08