| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
| Protein automated matches [190670] (7 species) not a true protein |
| Species Azospirillum brasilense [TaxId:192] [189362] (11 PDB entries) |
| Domain d3mhyb_: 3mhy B: [181234] automated match to d1gnka_ complexed with akg, atp, mes, mg, pg6 |
PDB Entry: 3mhy (more details), 1.4 Å
SCOPe Domain Sequences for d3mhyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mhyb_ d.58.5.1 (B:) automated matches {Azospirillum brasilense [TaxId: 192]}
mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgqteiyrgaeysvsflpkvk
vevavsddqyeqvveaiqkaantgrigdgkifvldiaqavrirtgetnteal
Timeline for d3mhyb_: