Lineage for d3mhwu_ (3mhw U:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2057409Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 2057410Species Human (Homo sapiens) [TaxId:9606] [50587] (79 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 2057412Domain d3mhwu_: 3mhw U: [181232]
    automated match to d1ejna_
    complexed with abv, so4

Details for d3mhwu_

PDB Entry: 3mhw (more details), 1.45 Å

PDB Description: The complex crystal Structure of Urokianse and 2-Aminobenzothiazole
PDB Compounds: (U:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d3mhwu_:

Sequence, based on SEQRES records: (download)

>d3mhwu_ b.47.1.2 (U:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtke

Sequence, based on observed residues (ATOM records): (download)

>d3mhwu_ b.47.1.2 (U:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadlahhndiallkirskegrcaqpsrtiqtis
lpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttkm
lcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpwi
rshtke

SCOPe Domain Coordinates for d3mhwu_:

Click to download the PDB-style file with coordinates for d3mhwu_.
(The format of our PDB-style files is described here.)

Timeline for d3mhwu_: