Lineage for d3mhra_ (3mhr A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 922384Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
  5. 922385Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 922429Protein automated matches [190238] (4 species)
    not a true protein
  7. 922435Species Human (Homo sapiens) [TaxId:9606] [187008] (22 PDB entries)
  8. 922438Domain d3mhra_: 3mhr A: [181230]
    automated match to d1qjaa_
    complexed with ca, cl, gol, mg

Details for d3mhra_

PDB Entry: 3mhr (more details), 1.15 Å

PDB Description: 14-3-3 sigma in complex with YAP pS127-peptide
PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d3mhra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mhra_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d3mhra_:

Click to download the PDB-style file with coordinates for d3mhra_.
(The format of our PDB-style files is described here.)

Timeline for d3mhra_: