SCOPe 2.08: Domain d3mhra1: 3mhr A:1-231

Lineage for d3mhra1 (3mhr A:1-231)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries)

8. Domain d3mhra1: 3mhr A:1-231 [181230]
   Other proteins in same PDB: d3mhra2
   automated match to d1qjaa_
   complexed with ca, cl, gol, mg

Details for d3mhra1

PDB Entry: 3mhr, 1.15 Å

PDB Description: 14-3-3 sigma in complex with YAP pS127-peptide

PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d3mhra1:

Sequence; same for both SEQRES and ATOM records:

>d3mhra1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Timeline for d3mhra1:

• d3mhra1 first appeared in SCOPe 2.01, called d3mhra_
  
• d3mhra1 appears in SCOPe 2.07