SCOPe 2.06: Domain d1hiwb_: 1hiw B:

Lineage for d1hiwb_ (1hiw B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
   automatically mapped to Pfam PF00540

6. Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species)
   topologically similar to one subunit in the interferon-gamma intertwined dimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (10 PDB entries)

8. Domain d1hiwb_: 1hiw B: [18123]
   complexed with so4

Details for d1hiwb_

PDB Entry: 1hiw, 2.3 Å

PDB Description: trimeric hiv-1 matrix protein

PDB Compounds: (B:) hiv-1 matrix protein

SCOPe Domain Sequences for d1hiwb_:

Sequence; same for both SEQRES and ATOM records:

>d1hiwb_ a.61.1.1 (B:) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1 [TaxId: 11676]}
vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlqp
slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaq

Timeline for d1hiwb_:

• d1hiwb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hiwb_ appears in SCOPe 2.05
  
• d1hiwb_ appears in SCOPe 2.07
  
• d1hiwb_ appears in the current release, SCOPe 2.08