SCOPe 2.06: Domain d3mhaa_: 3mha A:

Lineage for d3mhaa_ (3mha A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
   11 stranded sheet partly folded in a corner-like structure filled with a few short helices

4. Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families)

5. Family b.125.1.0: automated matches [191645] (1 protein)
   not a true family

6. Protein automated matches [191184] (3 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [189449] (4 PDB entries)

8. Domain d3mhaa_: 3mha A: [181220]
   Other proteins in same PDB: d3mhab2
   automated match to d2byoa1
   complexed with z69

Details for d3mhaa_

PDB Entry: 3mha, 1.85 Å

PDB Description: Crystal structure of LprG from Mycobacterium tuberculosis bound to PIM

PDB Compounds: (A:) Lipoprotein lprG

SCOPe Domain Sequences for d3mhaa_:

Sequence; same for both SEQRES and ATOM records:

>d3mhaa_ b.125.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaatgnvkltl
ggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlanfadakae
grdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaqldrgsgn
svqmtlskwgekvqv

Timeline for d3mhaa_:

• d3mhaa_ first appeared in SCOPe 2.01
  
• d3mhaa_ appears in SCOPe 2.05
  
• d3mhaa_ appears in SCOPe 2.07
  
• d3mhaa_ appears in the current release, SCOPe 2.08