Lineage for d3mgza_ (3mgz A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578543Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 2578544Superfamily d.115.1: YrdC/RibB [55821] (3 families) (S)
  5. 2578615Family d.115.1.0: automated matches [191657] (1 protein)
    not a true family
  6. 2578616Protein automated matches [191228] (2 species)
    not a true protein
  7. 2578617Species Mycobacterium tuberculosis [TaxId:419947] [189646] (3 PDB entries)
  8. 2578621Domain d3mgza_: 3mgz A: [181211]
    automated match to d1tksa_
    complexed with so4

Details for d3mgza_

PDB Entry: 3mgz (more details), 2.07 Å

PDB Description: Crystal structure of DHBPS domain of bi-functional DHBPS/GTP cyclohydrolase II from Mycobacterium tuberculosis at pH 4.0
PDB Compounds: (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d3mgza_:

Sequence, based on SEQRES records: (download)

>d3mgza_ d.115.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
mtrldsveravadiaagkavividdedrenegdlifaaekatpemvafmvrytsgylcvp
ldgaicdrlgllpmyavnqdkhgtaytvtvdarngigtgisasdrattmrlladptsvad
dftrpghvvplrakdggvlrrpghteaavdlarmaglqpagaiceivsqkdegsmahtde
lrvfadehglalitiadliewrrkhe

Sequence, based on observed residues (ATOM records): (download)

>d3mgza_ d.115.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
mtrldsveravadiaagkavividdrenegdlifaaekatpemvafmvrytsgylcvpld
gaicdrlgllpytvtvdarngigtgisasdrattmrlladptsvaddftrpghvvplrak
dggvlrrpghteaavdlarmaglqpagaiceivsmahtdelrvfadehglalitiadlie
wrrkhe

SCOPe Domain Coordinates for d3mgza_:

Click to download the PDB-style file with coordinates for d3mgza_.
(The format of our PDB-style files is described here.)

Timeline for d3mgza_: