Lineage for d3ezea1 (3eze A:22-144)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4264Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 4505Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family) (S)
  5. 4506Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein)
  6. 4507Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species)
  7. 4508Species Escherichia coli [TaxId:562] [47834] (11 PDB entries)
  8. 4512Domain d3ezea1: 3eze A:22-144 [18121]
    Other proteins in same PDB: d3ezea2, d3ezeb_

Details for d3ezea1

PDB Entry: 3eze (more details)

PDB Description: complex of the amino terminal domain of enzyme i and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure

SCOP Domain Sequences for d3ezea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezea1 a.60.10.1 (A:22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli}
deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle
deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni
lgl

SCOP Domain Coordinates for d3ezea1:

Click to download the PDB-style file with coordinates for d3ezea1.
(The format of our PDB-style files is described here.)

Timeline for d3ezea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ezea2
View in 3D
Domains from other chains:
(mouse over for more information)
d3ezeb_