Lineage for d3ezba1 (3ezb A:22-144)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1494191Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family) (S)
  5. 1494192Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein)
  6. 1494193Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species)
    inserted in the phosphohistidine domain
  7. 1494194Species Escherichia coli [TaxId:562] [47834] (11 PDB entries)
  8. 1494197Domain d3ezba1: 3ezb A:22-144 [18120]
    Other proteins in same PDB: d3ezba2, d3ezbb_

Details for d3ezba1

PDB Entry: 3ezb (more details)

PDB Description: complex of the amino terminal domain of enzyme i and the histidine- containing phosphocarrier protein hpr from escherichia coli
PDB Compounds: (A:) protein (phosphotransfer system, enzyme I)

SCOPe Domain Sequences for d3ezba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezba1 a.60.10.1 (A:22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli [TaxId: 562]}
deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle
deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni
lgl

SCOPe Domain Coordinates for d3ezba1:

Click to download the PDB-style file with coordinates for d3ezba1.
(The format of our PDB-style files is described here.)

Timeline for d3ezba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ezba2
View in 3D
Domains from other chains:
(mouse over for more information)
d3ezbb_