SCOPe 2.08: Domain d3mg8j_: 3mg8 J:

Lineage for d3mg8j_ (3mg8 J:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3mg8j_: 3mg8 J: [181174]
   Other proteins in same PDB: d3mg8a_, d3mg8b_, d3mg8c_, d3mg8d_, d3mg8e_, d3mg8f_, d3mg8g_, d3mg8l_, d3mg8o_, d3mg8p_, d3mg8q_, d3mg8r_, d3mg8s_, d3mg8t_, d3mg8u_, d3mg8z_
   automated match to d1g0uj_
   complexed with l3t, mes, mg

Details for d3mg8j_

PDB Entry: 3mg8, 2.59 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 16

PDB Compounds: (J:) Proteasome component C11

SCOPe Domain Sequences for d3mg8j_:

Sequence; same for both SEQRES and ATOM records:

>d3mg8j_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddfqaq

Timeline for d3mg8j_:

• d3mg8j_ first appeared in SCOPe 2.01
  
• d3mg8j_ appears in SCOPe 2.07