Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family) |
Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein) |
Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species) inserted in the phosphohistidine domain |
Species Escherichia coli [TaxId:562] [47834] (11 PDB entries) |
Domain d2ezaa1: 2eza A:22-144 [18116] Other proteins in same PDB: d2ezaa2 |
PDB Entry: 2eza (more details)
SCOPe Domain Sequences for d2ezaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ezaa1 a.60.10.1 (A:22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli [TaxId: 562]} deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni lgl
Timeline for d2ezaa1: