Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries) |
Domain d3mg7u_: 3mg7 U: [181159] Other proteins in same PDB: d3mg71_, d3mg72_, d3mg7a_, d3mg7b_, d3mg7c_, d3mg7d_, d3mg7e_, d3mg7f_, d3mg7h_, d3mg7i_, d3mg7j_, d3mg7k_, d3mg7m_, d3mg7n_, d3mg7o_, d3mg7p_, d3mg7q_, d3mg7r_, d3mg7s_, d3mg7t_, d3mg7v_, d3mg7w_, d3mg7x_, d3mg7y_ automated match to d1g65g_ complexed with l2t, mes, mg |
PDB Entry: 3mg7 (more details), 2.78 Å
SCOPe Domain Sequences for d3mg7u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mg7u_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia eqd
Timeline for d3mg7u_:
View in 3D Domains from other chains: (mouse over for more information) d3mg71_, d3mg72_, d3mg7a_, d3mg7b_, d3mg7c_, d3mg7d_, d3mg7e_, d3mg7f_, d3mg7g_, d3mg7h_, d3mg7i_, d3mg7j_, d3mg7k_, d3mg7l_, d3mg7m_, d3mg7n_, d3mg7o_, d3mg7p_, d3mg7q_, d3mg7r_, d3mg7s_, d3mg7t_, d3mg7v_, d3mg7w_, d3mg7x_, d3mg7y_, d3mg7z_ |