SCOPe 2.07: Domain d3mg6p_: 3mg6 P:

Lineage for d3mg6p_ (3mg6 P:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3mg6p_: 3mg6 P: [181131]
   Other proteins in same PDB: d3mg61_, d3mg62_, d3mg6d_, d3mg6g_, d3mg6h_, d3mg6i_, d3mg6j_, d3mg6k_, d3mg6l_, d3mg6m_, d3mg6n_, d3mg6r_, d3mg6u_, d3mg6v_, d3mg6w_, d3mg6x_, d3mg6y_, d3mg6z_
   automated match to d1g65b_
   complexed with lzt, mes, mg

Details for d3mg6p_

PDB Entry: 3mg6, 2.6 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 6

PDB Compounds: (P:) Proteasome component Y13

SCOPe Domain Sequences for d3mg6p_:

Sequence; same for both SEQRES and ATOM records:

>d3mg6p_ d.153.1.4 (P:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtsteklykln
dkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytqhgglrp
fgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddmkvddai
elalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvktgit

Timeline for d3mg6p_:

• d3mg6p_ first appeared in SCOPe 2.01
  
• d3mg6p_ appears in SCOPe 2.06
  
• d3mg6p_ appears in the current release, SCOPe 2.08