Lineage for d1ezaa1 (1eza A:22-144)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716372Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family) (S)
  5. 2716373Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein)
  6. 2716374Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species)
    inserted in the phosphohistidine domain
  7. 2716375Species Escherichia coli [TaxId:562] [47834] (11 PDB entries)
  8. 2716384Domain d1ezaa1: 1eza A:22-144 [18113]
    Other proteins in same PDB: d1ezaa2

Details for d1ezaa1

PDB Entry: 1eza (more details)

PDB Description: amino terminal domain of enzyme i from escherichia coli nmr, restrained regularized mean structure
PDB Compounds: (A:) enzyme I

SCOPe Domain Sequences for d1ezaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezaa1 a.60.10.1 (A:22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli [TaxId: 562]}
deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle
deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni
lgl

SCOPe Domain Coordinates for d1ezaa1:

Click to download the PDB-style file with coordinates for d1ezaa1.
(The format of our PDB-style files is described here.)

Timeline for d1ezaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ezaa2