SCOPe 2.06: Domain d3mg5a_: 3mg5 A:

Lineage for d3mg5a_ (3mg5 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (50 PDB entries)

8. Domain d3mg5a_: 3mg5 A: [181113]
   automated match to d1n9mc_
   complexed with btn, gol; mutant

Details for d3mg5a_

PDB Entry: 3mg5, 1.3 Å

PDB Description: core-streptavidin mutant f130l in complex with biotin

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d3mg5a_:

Sequence; same for both SEQRES and ATOM records:

>d3mg5a_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtltkvk

Timeline for d3mg5a_:

• d3mg5a_ first appeared in SCOPe 2.01
  
• d3mg5a_ appears in SCOPe 2.05
  
• d3mg5a_ appears in SCOPe 2.07
  
• d3mg5a_ appears in the current release, SCOPe 2.08