SCOP 1.57: Domain d1zymb1: 1zym B:22-144

Lineage for d1zymb1 (1zym B:22-144)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.60: SAM domain-like [47768] (10 superfamilies)

4. Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family)

5. Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein)

6. Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species)

7. Species Escherichia coli [TaxId:562] [47834] (11 PDB entries)

8. Domain d1zymb1: 1zym B:22-144 [18111]
   Other proteins in same PDB: d1zyma2, d1zymb2

Details for d1zymb1

PDB Entry: 1zym, 2.5 Å

PDB Description: amino terminal domain of enzyme i from escherichia coli

SCOP Domain Sequences for d1zymb1:

Sequence; same for both SEQRES and ATOM records:

>d1zymb1 a.60.10.1 (B:22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli}
deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle
deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni
lgl

Timeline for d1zymb1:

• d1zymb1 first appeared (with stable ids) in SCOP 1.55
  
• d1zymb1 appears in SCOP 1.59
  
• d1zymb1 appears in the current release, SCOPe 2.08