| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) ![]() |
| Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins) |
| Protein Flp recombinase [47829] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47830] (3 PDB entries) |
| Domain d1flod1: 1flo D:2-129 [18109] Other proteins in same PDB: d1floa2, d1flob2, d1floc2, d1flod2 |
PDB Entry: 1flo (more details), 2.65 Å
SCOP Domain Sequences for d1flod1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1flod1 a.60.9.1 (D:2-129) Flp recombinase {Baker's yeast (Saccharomyces cerevisiae)}
pqfdilcktppkvlvrqfverferpsgekialcaaeltylcwmithngtaikratfmsyn
tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyygqkhqsditdivs
slqlqfes
Timeline for d1flod1: