Lineage for d3mfvb_ (3mfv B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115323Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 protein domains)
    Pfam PF00491
  6. 2115344Protein Arginase [52770] (5 species)
  7. 2115376Species Human (Homo sapiens) [TaxId:9606] [142346] (26 PDB entries)
    Uniprot P05089 5-313
  8. 2115401Domain d3mfvb_: 3mfv B: [181084]
    automated match to d1wvaa1
    complexed with mn, z70

Details for d3mfvb_

PDB Entry: 3mfv (more details), 1.9 Å

PDB Description: Crystal structure of human arginase I in complex with 2-aminohomohistidine
PDB Compounds: (B:) Arginase-1

SCOPe Domain Sequences for d3mfvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mfvb_ c.42.1.1 (B:) Arginase {Human (Homo sapiens) [TaxId: 9606]}
rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
laregnhkpidyl

SCOPe Domain Coordinates for d3mfvb_:

Click to download the PDB-style file with coordinates for d3mfvb_.
(The format of our PDB-style files is described here.)

Timeline for d3mfvb_: