SCOPe 2.01: Domain d3mfqb_: 3mfq B:

Lineage for d3mfqb_ (3mfq B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.0: automated matches [191548] (1 protein)
   not a true family

6. Protein automated matches [190944] (3 species)
   not a true protein

7. Species Streptococcus suis [TaxId:391295] [189905] (1 PDB entry)

8. Domain d3mfqb_: 3mfq B: [181081]
   automated match to d1k0fa_
   complexed with zn

Details for d3mfqb_

PDB Entry: 3mfq, 2.6 Å

PDB Description: A Glance into the Metal Binding Specificity of TroA: Where Elaborate Behaviors Occur in the Active Center

PDB Compounds: (B:) High-affinity zinc uptake system protein znuA

SCOPe Domain Sequences for d3mfqb_:

Sequence; same for both SEQRES and ATOM records:

>d3mfqb_ c.92.2.0 (B:) automated matches {Streptococcus suis [TaxId: 391295]}
skprvavttsflndmvyqlagdeverdllipagedphlyvakssdlsklqkadlvlyhgl
hfegkmvealektgvavsknfnakdlntmdedgeeivdphfwfsiplyksavavaseelq
kllpakaemiqkntekyqaqlddlhawvekelsvipkesrylvtphdafnyfaasydftl
yapqgvstdsevansdmietvnliidhnikaiftesttnpermkklqeavkakggqvevv
tgegkelfsdslapegeegdtfidmykhnvklmvkylk

Timeline for d3mfqb_:

• d3mfqb_ is new in SCOPe 2.01-stable
  
• d3mfqb_ appears in SCOPe 2.02
  
• d3mfqb_ appears in the current release, SCOPe 2.08