Lineage for d1floc1 (1flo C:2-129)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4264Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 4482Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) (S)
  5. 4483Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 4496Protein Flp recombinase [47829] (1 species)
  7. 4497Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47830] (1 PDB entry)
  8. 4500Domain d1floc1: 1flo C:2-129 [18108]
    Other proteins in same PDB: d1floa2, d1flob2, d1floc2, d1flod2

Details for d1floc1

PDB Entry: 1flo (more details), 2.65 Å

PDB Description: FLP Recombinase-Holliday Junction Complex I

SCOP Domain Sequences for d1floc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1floc1 a.60.9.1 (C:2-129) Flp recombinase {Baker's yeast (Saccharomyces cerevisiae)}
pqfdilcktppkvlvrqfverferpsgekialcaaeltylcwmithngtaikratfmsyn
tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyygqkhqsditdivs
slqlqfes

SCOP Domain Coordinates for d1floc1:

Click to download the PDB-style file with coordinates for d1floc1.
(The format of our PDB-style files is described here.)

Timeline for d1floc1: