Lineage for d3mflm_ (3mfl M:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2769889Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2769890Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2770099Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 2770114Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries)
  8. 2770223Domain d3mflm_: 3mfl M: [181077]
    Other proteins in same PDB: d3mfla_, d3mflb_, d3mflc_
    automated match to d1ykmb1
    complexed with bme, cl, co3, dhy, fe, gol, so4; mutant

Details for d3mflm_

PDB Entry: 3mfl (more details), 1.78 Å

PDB Description: axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase
PDB Compounds: (M:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d3mflm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mflm_ b.3.6.1 (M:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgphpwrngpndwrpahiyfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc

SCOPe Domain Coordinates for d3mflm_:

Click to download the PDB-style file with coordinates for d3mflm_.
(The format of our PDB-style files is described here.)

Timeline for d3mflm_: